Par matière - Cristal




Après le "noir et or", voici pour les Fêtes
le "Noir et Argent"

Créée au départ pour une exposition dont le thème était les "Années Folles", cette parure trouvera évidemment sa place en cette fin d'année.
Coiffure emblématique de cette période, le bandeau avec bijou de cheveu redevient "BROCHE"



Reprenant le même motif, voici le collier avec ras de cou en métal, cabochons Swarovski, chaînes de strass...

...Et les boucles d'oreilles
AnneesFollesBO.JPG AnneesFollesBObis1.JPG


Collection "SAKURA"

Sakura1bis.jpg Sakura2.jpg Sakura3.jpg

COLLIER brodé à la soutache…

…créé à partir de superbes cristaux Swarovski,

…et agrémenté d’éléments précieux ( Nacres, Soie plissée shibori artisanale de Céline Souchu, chaîne de strass)


SakuraCollier1.JPG SakuraCollier2.JPG



A retrouver en boutique :

Une broche pour les fêtes

Revue en noir et argent, cette broche correspond au module 1 de mon collier créé pour un concours Perles&Co/Swarovski.
J'en avais fait un tutoriel que vous pouvez retrouver ici :

(Cristaux Swarovski - verre de Bohême - perles Miyuki - montage à la soutache - cuir - estampe - plume)

Elle peut être portée horizontalement....


...ou verticalement
Jolie finition à l'arrière avec une doublure en cuir d'agneau et une épingle-estampe.

Kimmidoll...Kokeshi ...
                   Voici  "MAMZELLE ELGA"

                            (Cristal - Cabochon fait main d' Elga Casagni - soutache- perles "Amos" en verre de Bohême)


Pour les Fêtes ...
                        Un " PASSIONATA " Crystal AB
                                   (Cristal Swarovski - soutache - Cuir)

Tutoriel sur ce site :




Bijoux transformables... 3 en 1... (pendentif, bijou de sac, broche)...
                      Voici mes nouveaux "DAROUS"
                                                (en cristal, brodés à la soutache)




Daroubleu.JPG Darouderriere.JPG Darouvert.JPG

                      Couleurs printanières pour le collier
              "ROSE AU VENT"

                                                 (Soie plissée SHIBORI , cristal Swarovski, flèches de nacre et soutache)


Voici ma création pour la St Valentin, en partenariat avec Perles & Co :
  le bracelet PASSIONATA

(bracelet en cuir ajouré, cabochons en cristal Swarovski, dentelle, soutache, chaîne de strass, cubes Miyuki, dagues en verre de Bohême)

Le tutoriel gratuit est sur Perles & Co et sur Mamzelle Pacotille .
On peut trouver tout le matériel nécessaire chez Perles&Co - liens directs en fin de tutoriel ici :





Nouveau look pour ma chouette 2017 !
                                  Voici "VALENTINE" !!!

Cette année le plumage de ma chouette est réalisé avec les perles japonaises "Long Magatama" qui se recouvrent partiellement à la façon des toujours les dagues pour les plumes de la queue.


Pendentif HEDWIG
                       ... dernier né de mes pendentifs "chouettes"
                                                              (d'après une création de Vezsuzsi)
      (Tissage de perles avec cristal Swarovski - verre de Bohême - perles japonaises Myuki)


PendentifHedwig2.JPG PendentifHedwig4.JPGPendentifHedwig3.JPG

Pendentif "HEDWIG" de Vezsuzsi.
(cristal Swarovski - verre de Bohême - perles japonaises Myuki)



         Collier SHEHERAZADE ou le mouvement dans les danses orientales
                       ... inspiré de cette photo du Ballet "Shéhérazade" - Rimsky Korsakov.





Boucles d'oreilles SHEHERAZADE
 ...   dans la même collection que le collier
             que j'ai créé pour le Concours Perles&Co-Swarovski
        (Cabochon en cristal Swarovski bien sûr - dagues en verre de Bohême - soutache -doublure en cuir d'agneau)



BOSheherazade3.JPG BOSheherazade4.JPG

Dans la Collection " PRINCESSE INDIA ",

         il y avait le bracelet braceletprincesseindia2.JPG   et les boucles d'oreilles  BOprincesseindia2.JPG 

                               Voici le collier-torque
                      (mélange de 2 techniques: Soutache et Soie Shibori)


colliertorqueprincesseindia3.JPG colliertorqueprincesseindia4.JPG

Un collier-torque turquoise dans ...
la Collection "PRINCESSE INDIA"
(Cristaux, soutache et soie Shibori)


      collierPrincesseIndiableu5.JPG collierPrincesseIndiableu6.JPG

Et sur fond blanc maintenant...

     collierPrincesseIndiableu12.JPG collierPrincesseIndiableu13.JPG collierPrincesseIndiableu14.JPG

C'est bientôt la Saint Valentin...
                       1er de la collection "CoeurShibori"

              le pendentif    "JOLI COMME UN COEUR"

                                                           (Soutache, soie Shibori, cristal, verre, rocailles et doublure en cuir)



                                                                           pendentifcoeurShiborivert3.JPG  pendentifcoeurShiborivert4.JPG

Dans la Collection "CoeurShibori"
                  Le pendentif  "ACCROCHE-COEUR"

                   Coeur brodé sur Lacy's stiff stuff (sorte d'intissé) avec inclusion de Soie Shibori plissée.
   (soutache - jade purple - cristal - dagues et O bead en verre de Bohême - chaîne strassée - rocailles japonaises )

pendentifaccrochecoeur0.JPG pendentifaccrochecoeur1.JPG
pendentifaccrochecoeur2.JPG pendentifaccrochecoeur3.JPG

Doublure en cuir à l'arrière....                           pendentifaccrochecoeur4.JPG

...La collection "COEURSHIBORI" s'enrichit avec
                    Le pendentif  "COEUR ENFLAMME"

                                                              (Soie Shibori - cristal - chaîne strassée - soutache - rocailles myuki)




               pendentifcoeurenflamme3.JPG le dernier de la collection "COEURSHIBORI"            
               le pendentif  "Coeur Chaviré"  
                                  (Soie shibori - soutache - cristaux- estampe - chaîne strass - rocailles - cuir)

coeurshiboricoeurchavire1.JPG  coeurshiboricoeurchavire2.JPG

                    coeurshiboricoeurchavire3.JPG  coeurshiboricoeurchavire5.JPG  coeurshiboricoeurchavire4.JPG


Dans les tons cuivrés et noirs, avec la nouvelle couleur de cristal Swarovski or rose ("Rose Gold)...
       Parure "VENT DE BOHEME"
                     (Soutache, cristal Swarovski, verre de Bohême, chaîne strass, cubes et rocailles Myuki)

Le collier ... monté sur un tour de cou en cuivre.

CollierVentdeBoheme2.JPG CollierVentdeBoheme3.JPG

Les boucles d'oreilles...

BOVentdeBoheme1.JPG BOVentdeBoheme2.JPG



         Collier-torque   ONGLE DE VENUS 
                   (Onyx, cristal et chaîne de strass Swarovski, délicas Myuki, soutache )
Le nom de l'onyx - ongle ou griffe en grec - est tiré d'une légende...
"Un jour, alors que Venus dormait, Cupidon lui coupa les ongles et les laissa dispersés sur le sol. Les Parques les ramassèrent et les transformèrent en une pierre fine: l'ONYX."

OngledeVenus1.JPG OngledeVenus2.JPG OngledeVenus3.JPG

Je démarre doucement l'année...
              avec un    Bracelet "VITRAIL"  de Puca

                   Voici mon interprétation sur bracelet en cuir - cristal et verre de Bohême -


    braceletvitrail1.JPG braceletvitrail3.JPG braceletvitrail4.JPG

Nouveau   Bracelet "VITRAIL"...
                           ...avec une base de bracelet strassé 3 tours



Un joli schéma de PUCA ...aussitôt réalisé, et voici...

les "BO Isabelle Scarabeus" !
(Cabochon en cristal Swarovski de couleur "Scarabeus", pellets (ou diabolos) et dagues en verre de Bohême, toupies en cristal, perles japonaises) 

Et comme d'habitude, dès que je peux mettre des dagues...
Ne sont-elles pas élégantes ?

BOIsabellescarabeus3.JPG BOIsabellescarabeus2.JPG


...Et la famille s'agrandit


               sont arrivées...

                                                         Des cadeaux en perspective !!!

       Chouettesdelete2.JPG Chouettesdelete3.JPG Chouettesdelete4.JPG Chouettesdelete5.JPG


          "TENUE DE FETE"
                   pour ce pendentif noir et métallic Sunshine .
                                                        (cristal Swarovski, soutache)

gouttenoiror2.JPG gouttenoiror1.JPG

Cousin du pendentif "Goutte de rosée", voici
                                                            ( cristal Swarovski, soutache)

PendentifGouttederosee_noir1.JPG PendentifGoiuttederosee3.JPG

Petit air de famille avec le collier "Princesse India"...
    Pendentif  "Perle de rosée"
                                                                            (Cristaux Swarovski, soutaches métalliques, cuir)

pendentifgouttedor2.JPG pendentifgouttedor1.JPG pendentifgouttedor3.JPG

Toujours dingue de dagues!!!
                    Voici le collier "VENEZIA"


       (Tour de cou plat métal argenté - gouttes onyx - cabochons ronds et navette en cristal Swarovski - délicas japonais - soutache - dagues en verre de Bohême)


                                                                                            collierVenezia2a.JPG  parureVeneziacollierbracelet.JPG

Le bracelet "HELIOTROPE"
  (Cabochon 27mm de cristal Swarovski -coloris "héliotrope", chaîne et boules strassées, perles magiques et soutache)

braceletheliotropesurmainnoire.JPG braceletheliotropesurmainnoiregrosplan.JPG


Et avec les boucles d'oreilles assorties...


"LES ASYMETRICK"... pendentifs et bagues assorties

Tout d'abord avec du "Crystal Antique Pink", avec un montage rose pâle satiné, une des teintes de l'automne 2014...

parurebaguependentifAsymetrikantiquepink.JPG pendentifAsymetrikantiquepinkgrosplan.JPG



Dans un style rétro...un tantinet kitch,


                                              Un ensemble "ASYMETRIK"
                              utilisant la teinte  "Crystal Lilac Shadow" de Swarovski
                                               avec son flashage métallique doré

Bague et pendentif

baguelilacshadow1.JPG  baguelilacshadow2.JPG

pendentiflilacshadow3.JPG  pendentiflilacshadowgrosplan5.JPG


Et avec les coloris "Astral Pink" et "Turquoise"...

pendentifasymetrichastralpink.jpg pendentifasymetrickturquoise.jpg

bagueasymetrickturquoise.jpg bagueasymetrickastralpink.jpg

                                                    pendentifsetbaguesasymetrickturquoiseastralpink.jpg pendentifasymetrickturquoiseetastralpink.jpg bagueasymetricksurmainastralpink1.jpg bagueasymetrickturquoisesurmain.jpg

La Manchette "Newmango"
(sertissage en étoile d'un cabochon ovale 30x22)
braceletMangoprofil.jpg braceletMangoface.jpg

Sertissage de cabochons en cristal (8 et 18mm)

Les chouettes Chouettes à Zibou



pendentifzibougrosplan2.jpg chouette2.jpg



Avec des gouttes et poires Swarovski


                                     Pendentif_goutte_larme-gros_plan.jpg Pendentif_goutte-larme_et_BO.jpg

 poire_noire_et_or_gros_plan.jpg Poire_noire_et_or.jpg


poire_crystalAB_argent_gros_plan.jpg poire_crystalABargent.jpg

pendentif_goutte_violette_face1.jpg pendentif_goutte_violette_face2.jpg

pendentif_gros_coeur_bicol_noir_or.jpg pendentif_gros_coeur_gros_plan1.jpg pendentif_gros_coeur_gros_plan2.jpg




       Avec des petits coeurs en cristal...





Pendentif "TOURNESOL"

                           pendentif_nenuphar_double_topaze.jpg pendentif_nenuphar_double_topaze_grosplan2.jpg




                                                                     Le collier "MARGAUX"


                                                                  "Le trèfle de cristal"

                  Parure_coeursde18_Nenuphar.jpg Pendentif_Coeurs_de_18.jpg



Avec des éléments percés: CARRES EVIDES - DONUTS cristal





         colliernoldonutswarogris.jpg colliernoeldonutswarotopaze.jpg


Avec des cabochons sertis...

                                                                                                             Pendentif "THOUERIS"



          Pendentif  "BERMUDES"                                                             Pendentif "EYES"


pendentif_Bermudes_gros_plan.jpg pendentif_Eyes_gros_plan.jpg



                                                                         Cabochons sertis en étoile



Créations avec d'autres composants Swarovski

    COLLIER_PRESSIND_TOPAZE_EN_ENTIER.jpg collier_pressing_topaze_gros_plan.jpg










Date de création : 22/04/2013 @ 22:04
Dernière modification : 26/12/2020 @ 20:24
Catégorie : Par matière

Imprimer l'article Imprimer l'article

Nous contacter
Plaisir des yeux


 353268 visiteurs

 3 visiteurs en ligne

^ Haut ^