Par genre - Colliers Pendentifs (1)

         COLLECTION                    COLLIERS




Pendentif/Broche "GLAÇON"

....L'hiver n'a pas dit son dernier mot !!!



(Agate veinée mate, perles en cristal de roche craquelé et en nacre, cristaux, verre de Bohême, cuir façonné à la main, sertissage et montage cousus main en technique "soutache")

Glaon2.JPG Glaon1.JPG



A retrouver en boutique :



Dans la collection "Peintres d'hier et d'aujourd'hui"...

Avec l'arrivée du printemps, le "JARDIN MAGIQUE" se réveille...
Des pousses bizarres apparaissent...

Collier *The twin*

( Cabochon peint à la main de Teresa Ferreira Lopes, d'après des dessins de Joe Patouille, soie plissée shibori artisanale de Céline Souchu, porcelaine froide modelée à la main de Daniela Oprescu, cristaux, verre de Bohême, sertissage et montage cousus main à la soutache)


JardinmagiqueThetwin2.JPG JardinmagiqueThetwin3.JPG

JardinmagiqueThetwin5.JPG JardinmagiqueThetwin6.JPG


A retrouver en boutique :



Collection "LA DAME DU LAC"

Collier *Le retour*

Daedra.jpgDamedulac1.jpg images.jpg

(Cabochons dichroïques d' Ivanna Harchenko, fleur en porcelaine froide artisanale de Daniela Oprescu, verre, chaîne de strass, sertissage et montage cousus main en technique "soutache")


Viviane1.JPG Viviane9.JPG

A retrouver en boutique :




Un YLANG YLANG très printanier
a percé la neige...

(Cabochons faits main de l'artiste Elga CASAGNI, soie plissée shibori artisanale de Céline SOUCHU, cristaux, verre de Bohême, chaîne de strass, sertissage et montage cousus main en technique soutache)

Le Collier et ...


CommeuneenviedeprintempsP1.JPG CommeuneenviedeprintempsP2a.JPG CommeuneenviedeprintempsP2o.JPG


La Parure


A retrouver en boutique :




Pas de couleurs éclatantes cette année,
CARNAVAL est triste...
Covid a tout gâché !

(masque en zamak, cristal, goutte en onyx, chaîne de strass, sertissage et montage cousus main à la soutache)

Bijou 3 en 1
Pendentif sur ras de cou rigide 
Pendentif sur long sautoir

...en ras de cou sur collier métallique rigide

VenisePB2.JPG VenisePB1.JPG
en sautoir chaîne serpent
(de 3mm de diamètre, 70cm delong)

VenisePB6.JPG VenisePB7bis.JPG
en broche


A retrouver en boutique :



Avec la collection "COEUR D'OR"



(Cabochons faits main par Teresa FERREIRA LOPES, cristal, verre de Bohême, sertissage et montage cousus main à la soutache)


CoeurdorPendentif1.JPG CoeurdorBO1.JPG

CoeurdorParure2.JPG CoeurdorPendentif3.JPG

A retrouver en boutique :



Dernière ligne droite pour la Saint Valentin !!! (1)

Une première collection... " COEURS ENLACES"

(Cabochons artisanaux de Simona ROTARIS,
sertissage et montage cousus main à la soutache)

Coeursenlacescollier1.JPG CoeursenlacesCollier2.JPG CoeursenlacesBO2.JPG

CoeursenlacesParure1.JPG CoeursenlacesParure2.JPG

A retrouver en boutique :




Le Pendentif/Broche COEUR A COEURS-

Bijou brodé avec des coeurs Swarovski, évidemment !

( Soie plissée artisanale de Kateryna YEREMEYEVA, cristaux Swarovski, verre, chaîne de strass, sertissage et montage cousus main à la soutache, doublure en cuir d'agneau)


CoeurShiboriVO1d.JPG CoeurShiboriVO2g.JPG

Sous toutes les coutures pour admirer le gonflant du Shibori

CoeurShiboriVO3b.JPG CoeurShiboriVO3.JPG CoeurShiboriVO3a.JPG

Bijou 2 en 1
C'est un pendentif, mais aussi une broche !

A retrouver en boutique :



Saint Valentin ..."ROUGE PASSION" et "TOTEM"

pour les deux dernières créations de la collection "ARA MACAO"


(Cabochons faits main, créés par l’artiste Milena Scarcella, cristaux, verre, tulle brodé, soutache.)

Le Collier ...


ARAMACAORougePassion11.JPG ARAMACAORougePassion1.JPG

A retrouver en boutique :





Le Pendentif/Broche "COEUR FLEUR BLEUE"

(Magnifique soie artisanale de Kateryna Yeremeyeva, cristaux, chaîne de strass, en techniques de BRODERIE DE PERLES et de SOUTACHE -entièrement cousu main-)


Le coeur sous toutes ses "coutures" pour admirer le gonflant de la soie plissée

CoeurShiboriFleurBleue1bis.JPG CoeurShiboriFleurBleue2v.JPG CoeurShiboriFleurBleue2u.JPG


Le collier et la broche

CoeurShiboriFleurBleue9.JPG CoeurShiboriFleurBleue10.JPG

A retrouver en boutique :



Collection "YLANG Black and Silver"
Pendentif "Oiseau d'argent"

(Cabochons d'Ivanna Harchenko, cristaux, verre de Bohême, plume, sertissage et montage cousus main en technique soutache)
Davantage de photos vers ma boutique :

YlangOiseaudargentPendentif1.JPG YlangOiseaudargentPendentif2.JPG YlangOiseaudargentPendentif3.JPG

YlangOiseaudargentPendentif5.JPG YlangOiseaudargentPendentif7.JPG

A retrouver en boutique :




Dans la Collection "PIERRES NATURELLES"...(1)

Des pendentifs ...

(pierres naturelles, cuir, verre de Bohême, sertissage et montage cousus main à la soutache)










Collection   ARA MACAO

Pendentif  "ERUPTION"

(Cabochon polymère incrusté de strass Swarovski puis résiné, fait main, de l'artiste Milena SCARCELLA, cristaux, verre, montage cousu main à la soutache, doublé cuir d'agneau, tour de cou rigide)







Après le "noir et or", voici pour les Fêtes
le "Noir et Argent"

Créée au départ pour une exposition dont le thème était les "Années Folles", cette parure trouvera évidemment sa place en cette fin d'année.
Coiffure emblématique de cette période, le bandeau avec bijou de cheveu redevient "BROCHE"



Reprenant le même motif, voici le collier avec ras de cou en métal, cabochons Swarovski, chaînes de strass...




Toute une collection de..."PEPITES" !!!
*Pour les fêtes de fin d'année*

Le pendentif

(Cabochons de l'artiste Olimpia CORVINO, cristaux, verre, montage cousu main  en technique "soutache")

PepiteCollier4.JPG PepiteCollier6.JPG

Les Boucles d'oreilles

(Cabochons artisanaux, verre de Bohême, cristaux, soutache)


 Chaque boucle d'oreille peut se transformer en pendentif !

PepiteBO2b.JPG PepiteBO2d.JPG

A retrouver en boutique :





Le pendentif

(Cabochon fait-main créé par Daniela OPRESCU, cristaux, montage cousu main en technique soutache, doublé cuir, tour de cou cuir)


PourpredAutomne2.JPG PourpredAutomne4.JPG

A retrouver en boutique :


-Le collier-
(Cabochons 3D et design inspiré de Simona ROTARIS, cristaux, verre de Bohême)
Montage à la soutache cousu main


Effet volume grâce aux cabochons incurvés...


A retrouver en boutique :

Collection  "ARA MACAO" (suite) -

Voici le pendentif et les boucles d'oreilles parure est maintenant complète !

(Cabochons incrustés de cristaux Swarovski faits main, créés par l'artiste Milena Scarcella, cristaux, verre, tulle brodé, doublure en cuir d'agneau, montage cousu main en technique "soutache")


AraMacaoPendentif2.JPG AraMacaoBO4.JPG

AraMacaoPendentif3.JPG AraMacaoBOBracelet.JPG


A retrouver en boutique :




Collection   "Orange brûlé"
... couleur phare de cet automne


 Le collier
(cabochon de l'artiste Claudia CATTANEO, soie plissée shibori de Céline SOUCHU, cristaux, verre, feuille en nacre,  montage cousu main à la soutache -technique Haute Couture)





A retrouver en boutique :


Un dernier écho de l'opération
"J'expose un artisan d'art"

Encore merci à Agathe BIBAS pour son accueil et sa gentillesse !!!


J'ai essayé de saisir l'atmosphère de cet espace de soins et de bien-être par une création spéciale avec ces "GAUTAMA BOUDDHA" invités pour la circonstance...

Bijoux transformables ... BROCHES / PENDENTIFS

(cabochons créés par l'artiste italienne Monica STORCHI, cristaux Swarovski, montage cousu main à la soutache - technique Haute Couture- )

En broche...

Bouddhaor1.JPG Bouddhaor4.JPG

En pendentif

Bouddhaor2.JPG Bouddhaor3.JPG

Bouddhanoir1.JPG Bouddhanoir2.JPG Bouddhanoir3.JPG Bouddhanoir4.JPG

Bouddhargent3.JPG Bouddhargent2.JPG Bouddhargent1.JPG 

A retrouver en boutique :

Peintres d'hier et d'aujourd'hui ...



(Cabochons peints à la main par l'artiste Simona ROTARIS, Fleur en porcelaine froide de Daniela OPRESCU, cristaux, verre, cuir, sertissage et montage cousus main à la soutache)

Collier multiposition

(grâce à des coulisseaux aménagés dans la doublure en cuir)

GerbedautomneP1bis.JPG GerbedautomneP1.JPG


GerbedautomneP2bis.JPG GerbedautomneP2.JPG

GerbedautomneP3bisa.JPG GerbedautomneP3.JPG




Dans la collection "Peintres d'hier et d'aujourd'hui"...

*Le collier*

( Cabochon peint à la main de Teresa Ferreira Lopes, d'après des dessins de Joe Patouille, soie plissée shibori artisanale de Céline Souchu, porcelaine froide modelée à la main de Daniela Oprescu, cristaux, verre de Bohême, sertissage et montage cousus main à la soutache)


JardinMagiquePendentif3.JPG JardinMagiquePendentif7.JPG JardinMagiquePendentif1bis.JPG

 JardinMagiquePendentif11.JPG JardinMagiquePendentif10.JPG JardinMagiquePendentif12.JPG

A retrouver en boutique :

  La broche ...transformable
en pendentif !

(Cabochon peint à la main de Simona Rotaris, Soie plissée shibori de Céline Souchu, porcelaine froide façonnée à la main de Daniela Oprescu, cristal et verre de Bohême, sertissage et montage cousu main à la soutache)




... Et le Pendentif



A retrouver en boutique :


Dans la collection " PEINTRES D'HIER ET D'AUJOURD'HUI ", voici...




Le collier 

(Cabochons peints sur bois par l'artiste Simona ROTARIS, porcelaine froide de Daniela OPRESCU, verre, cristaux, montage cousu main à la soutache.)

*Collier transformable*
*3 positions du motif grâce à 3 "tunnels" en cuir aménagés dans la doublure*




La Parure


A retrouver en boutique :



Collection "HELIANTHUS" (suite et fin)

La broche transformable en pendentif...
(Cabochon fait main créé par l'artiste Stefania IUCCI, verre de Bohême, cuir façonné main, sertissage cousu à la soutache)

(Les bijoux transformables sont de plus en plus prisés, ils nous accompagnent lors des différentes saisons...pour magnifier un décolleté ou orner un revers de veste ou de manteau)





A retrouver en boutique :

Collection "La Dame du Lac"

Damedulac1.jpg Damedulac2.jpeg Damedulac3bis.jpg

Inspirée par la FEE VIVIANE, la Dame du Lac ...

Collier ...
(Cabochons de la créatrice Stefania IUCCI, soie plissée shibori artisanale de Céline Souchu, porcelaine froide artisanale, cristaux, verre, chaîne de strass, montage cousu main en technique de soutache.)






Inspiré par ces derniers jours de mini canicule, voici
Le Pendentif
(magnifique cabochon de Teresa Ferreira Lopes, cristaux, verre, montage cousu main à la soutache)



Et la parure avec les boucles d'oreilles

OndataDiCalorePendentif5bis.JPG OndataDiCalorePendentif3bis.JPG

A retrouver en boutique :

Collection "LE CYGNE VERT"  (suite)

Envie de Nature avec le déconfinement !


Après le collier, la broche transformable en pendentif
(Turquoise Chalk green , cristal, verre de Bohême, cuir, montage cousu à la soutache)

CygneVertBrocheCollierarriere1.JPG CygneVertBrocheCollierarriere2.JPG

CygneVertBrocheCollierarriere3.JPG CygneVertCollierBrocheavant.JPG

Et maintenant toute la parure




Collection  "CROCUS"


Création à 8 mains !

(Cabochon de Claudia CATTANEO, soie plissée shibori de Kateryna YEREMEYEVA, crocus en porcelaine froide modelée à la main par Daniela  OPRESCU, cristaux, verre, montage cousu main à la soutache)


CrocusCollier1.JPG CrocusCollier6.JPG CrocusCollier7.JPG


A retrouver en boutique :




Collection "SAKURA"

Sakura1bis.jpg Sakura2.jpg Sakura3.jpg

COLLIER brodé à la soutache…

…créé à partir de superbes cristaux Swarovski,

…et agrémenté d’éléments précieux ( Nacres, Soie plissée shibori artisanale de Céline Souchu, chaîne de strass)


SakuraCollier1.JPG SakuraCollier2.JPG



A retrouver en boutique :


Collection     "Le signe du...CYGNE VERT"

cygne-1162273945-1279920.jpg CygneVertDavos.jpg
                                                                                                                        Bergame...      ou     Davos...

Le Collier
(Magnifique cabochon de pierre naturelle : Turquoise chalk green - cristal - chaîne de strass - verre de Bohême - soie plissée shibori de Céline Souchu - sertissage à la soutache, cousu main)



CygneVertCollier2.JPG CygneVertCollier3.JPG CygneVertCollier4.JPG

A retrouver en boutique :



Collection   "OCTOPUS BLOOD"
                                                             * Le poulpe au sang bleu"

(Cabochon fait-main créé par Sonia ARRU, cristaux, chaîne de strass, doublé cuir, tour de cou cuir 3mm ou tour de cuir rigide doré)

b5eb2896fae8b632d03c1b619ffe7795--ocean-creatures-underwater-creatures.jpg hqdefault.jpg octopus.jpg

Le Collier...



Avec possibilité de changer de tour de cou
(en métal rigide ou en cuir de 3mm)
Et avec 2 positionnements:
(2 passants en cuir prévus dans la doublure)


OctopusCollier5.JPG OctopusCollier4.JPG OctopusCollier6.JPG

A retrouver en boutique :

Collection Hélianthus

Du soleil, des fleurs, pour doper notre énergie !!!


(cabochon fait main, créé par Stefania IUCCI, verre de Bohême, cuir)




A retrouver en boutique :


Une envie de réconfort, de chaleur et de couleurs avec cette collection !!!


Le Collier
Cabochons de l'artiste Simona Rotaris, cristaux, verre de Bohême, chaîne de strass, soie plissée shibori de la créatrice Céline Souchu, fleurs en polymère d'Olimpia Corvino, doublure cuir, montage cousu-main à la soutache.)


PepsOrangeCollier3.JPG PepsOrangeCollier4.JPG


A retrouver en boutique :

La parure



A retrouver en boutique :




Est-ce le confinement qui me donne cette envie de nature ???

(Cabochon fait main par l'artiste Stefania Iucci -tour de cou rigide - verre de Bohême - cristal - pierre de jade - soutache)


Eclosion_printaniere2.JPG Eclosion_printaniere3.JPG

EclosionPrintaniere4bis.JPG EclosionPrintaniere5.JPG

A retrouver en boutique :

Au revoir CARNAVAL



(Cabochons d'Olimpia Corvino, cristal, verre de Bohême, soie plissée Shibori de Kateryna Yeremeyeva, simili cuir, montage cousu main à la soutache)

CarnavalBroche1.JPG CarnavalBroche2.JPG


A retrouver en boutique :




Collection "MANCHOT GIVRE"
Neige sur les Hautes Vosges ...
Nouvel habitant sur les Crêtes ???

Le pendentif "Manchot givré"

*Cabochon fait main, créé par l’artiste Stefania Iucci, cristaux, chaîne strass, fourrure, soutache .
Le bijou est doublé de cuir d’agneau.
*Le tour de cou est en cuir.




* à retrouver dans la boutique*




Les rares flocons tombés
se sont déjà envolés...
...sur mes bijoux !!!

...Sur le pendentif 
*C'est le nom de l'artiste qui a peint ce paysage (peinture sur toile)*
(cristal, fourrure, chaîne strass, soutache)




* à retrouver dans la boutique*


Pour la Saint Valentin ...

gifs-animes-saint-valentin-myEx9Er41l.gif 12644951_1085073554877188_6365576274206706096_n.jpg gifs-animes-saint-valentin-myEx9Er41l.gif

 Voici mes...
"Coeurs Chavirés"

(Soie plissée shibori de Kateryna Yeremeyeva, cristaux Swarovski, chaîne de strass, verre de Bohême, doublure cuir d'agneau)
Tour de cou plat rigide en acier
Montage cousu main à la soutache

Lequel allez-vous préférer ?
 En fuschia/lie de vin ...


D'autres vues pour admirer le plissage ...

Coeurchavire3.JPG Coeurchavire4.JPG


ou en dégradé de bleus...


CoeurChavirebis2.JPG CoeurChavirebis3.JPG


                           *à retrouver dans la boutique*   



Collection ... ARA MACAO


Le Collier

(Magnifique cabochon fait main par l'artiste Milena Scarcella, soie plissée shibori de Céline Souchu, cristal, verre de Bohême, cousu main en broderie soutache)


AraMacaoCollier4.JPG AraMacaoCollier3.JPG





Jamais une pierre n'aura aussi bien porté son nom !!!

(Cabochon et perles en pierre naturelle : JASPE PAYSAGE, montage sobre cousu main à la soutache, doublure en cuir d'agneau, tour de cou en cuir tressé)







Voilà ce que m'a inspiré le kit créé par Simona ROTARIS
(cabochon artisanal, cristaux, longue goutte Swarovski, verre de Bohême...
sertis et cousus main à la soutache)





La tendance animalière s'affirme encore cet automne/hiver, avec plus particulièrement des imprimés "Serpent".
Voici mon interprétation : "SERPENTARD"

(cabochons de l'artiste russe Ivanna Harchenko, soie shibori de Céline Souchu , cuir de serpent pour le bracelet, cristaux, verre, sertissage/montage à la soutache)


CollierBlackSnakes1.JPG CollierBlackSnakes2.JPG




La "Tempête AMELIE"
arrive sur la France !!!
...ça va décoiffer !!!
Premiers effets constatés avec les


MamzelleHirsute2.JPG MamzelleHirsute4.JPG MamzelleHirsute3.JPG MamzelleHirsute5.JPG MamzelleHirsute6.JPG






(Cabochons créés par l'artiste Teresa Pereira Lopes, cuir, cristaux, verre de Bohême, pierres naturelles, fourrure)

Les colliers...


Automnedoretdefeu2.JPG Automnedoretdefeu3.JPG


Collier "SCARABEE"

Nadia m'a offert un magnifique cabochon qui s'est alors transformé en...
(Cabochon artisanal de Nadia Her , cristaux, chaîne strass, verre de Bohême, montage et couture à la soutache)







(magnifiques cabochons faits main par l'artiste italienne Stefania IUCCI, soie plissée shibori de Céline SOUCHU, cristaux SWAROVSKI, chaîne strass, montage et couture à la soutache)








Les imprimés animaliers étant toujours très tendance dans la collection Automne/Hiver...
          Voici la Collection   "SOMBRE TIGRESSE" !!!


(avec les magnifiques cabochons créés par Olimpia Corvino, cristaux Swarovski, fourrure, chaîne strass, verre...le tout serti et cousu main à la soutache)

*Le collier*

SombreTigresseCollier2.JPG Sombretigresseanimalier.jpg


La parure ...






La barge rousse migre à l'automne, elle va parcourir en vol plus de 10.000 kilomètres
en 8 jours et sans escale !
C'est la championne de la Migration !!!

( Cabochons faits main par l'artiste italienne Simona ROTARIS, Soie plissée shibori de Céline SOUCHU, Agate druzy or, Verre de Bohême, montage à la Soutache)






Et pour la fin des vacances...




(cabochon artisanal de Simona Rotaris, soie plissée shibori de Céline Souchu, verre, cristal, chaîne strass - montage à la soutache)





Collection "ONYX SOLAIRE"

Le jaune est encore à la mode pour l'automne-hiver 2019/2020...

(cabochons d' Ivanna Harchenko , cuir, verre de Bohême, sertissage soutache)

Le collier....



La parure ...



Dame Nature est à féliciter pour ce

(montage minimal à la soutache - verre de Bohême)





...très influencé par la météo des derniers jours !!!!


(magnifique cabochon de Teresa Ferreira Lopes, superbe soie shibori de Céline Souchu, cristaux, verre, montage à la soutache)







Mais quel est cet animal étrange ???

(cabochons artisanaux de Simona Rotaris, cristaux, soie plissée shibori de Céline Souchu)






Début de la collection

Envie de couleurs chaudes et de senteurs énivrantes...
(Cristal, cabochons d'Elga Casagni, soie plissée shibori de Céline Souchu, montage à la soutache)

YlangYlangdeMacassar1.JPG 3186410_1ed7cf2a0a_360x.jpg




Collection "CORAL FLOWER"

...Inspirée par la couleur PANTONE 2019                          56823362_2632575086774821_1996763556137140224_n.jpg 5ce6958ac60b8.jpeg

...Avec les magnifiques cabochons de Monica Storchi et la luxueuse soie plissée shibori de Céline Souchu

Fleur et feuille en cuir de ma fabrication.

Le collier





Collection    "PEPPERMINT"

Tout est vert autour de moi...
Le soleil est revenu. Je sirote sur ma terrasse ...

(Cabochon artisanal de Ivanna Harchenko, soie plissée shibori de Céline Souchu, cristal et verre de Bohême )


B2.JPG BOPeppermint_bis.JPG


Style animalier...   Collection "Léopard"


...Avec les magnifiques cabochons faits main de la créatrice italienne Milena Scarcella, des cristaux, du vison, le tout serti à la soutache.
Le collier...

Le bracelet...


Les boucles d'oreilles...


Et toute la parure...


        SECRET GARDEN...(jumeau du précédent)

...toujours avec le magnifique cabochon, mais en symétrique, de Simona Secchi, travaillé cette fois avec du cuir d'agneau que j'ai patiemment façonné !!!




Thème "NATURE"...

Voici le collier "SECRET GARDEN"

(magnifique cabochon peint à la main de Simona Secchi - soie plissée shibori de Céline Souchu - cristaux - montage à la soutache)



Collier pendentif
"INNAMORATO PAZZO" (Fou amoureux !)








Un bijou 2 en 1 ...
A la fois pendentif et broche

Le superbe cabochon de l'artiste italienne Simona Rotaris a revêtu sa tenue hivernale !
(cristal Swarovski, verre de Bohême, fourrure et cuir)

Spiraledellamore1.JPG Spiraledellamore2.JPG




Tour de cou ... "DROPS OF LOVE"

(Tour de cou dentelle et velours, feuille dentelle artisanale, gouttes de verre,soie shibori de Céline SOUCHU et magnifiques cabochons artisanaux de l'artiste Simona ROTARIS)



Petit pendentif... MAMZELLE ELGA

Une nouvelle "MAMZELLE" avec les délicieux cabochons d'Elga Casagni , un peu de tulle brodé et un montage à la soutache
(petit air de famille avec "Mamzelle AMPHORA"


Souvenir des Fêtes...



... A la fois pendentif et broche !!!

... Avec un magnifique cabochon "feuille d'or" de Simona Rotaris, un quartz druzy or, de la superbe soie plissée shibori noire et or de Céline Souchu et des perles tchèques "Plumes d'oiseau". Montage à la soutache.


Gros plan sur le cabochon à la feuille d'or craquelée:


... à la fois pendentif et broche (doublure en cuir d'agneau):






Les premiers flocons de neige m'ont inspirée, mais aussi les cabochons de Milena Scarcella.
Un peu de neige pour le traîneau du Père Noël !!!
(Cabochons faits main, soie plissée shibori de Céline Souchu, montage à la soutache)






Dernier né de la Collection Indonésie...   Après "BALI", "JAVA", voici ...
                         "MAKASSAR" (en SULAWESI)
                  costumes et ses fonds marins si colorés !

(Cabochons de Elga Casagni , soie shibori de Céline Souchu , cristaux, chaîne strass, montage soutache)

                             SULAWESIcollier5.jpg SULAWESIcollier6.jpg





Collier et bracelet   "菊花 ... JIUHUA"
Le chrysanthème, « Jiuhua », fleur de la neuvième lune ou « lune d’octobre », symbolise l’automne. Cultivée en Chine depuis plus de 2500 ans, elle symbolise la paix, la vie paisible, la constance, la longue vie…

(cabochons faits main de Simona Rotaris, cristal, verre de Bohême, soie shibori, montage à la soutache.)








  Pendentif  "MERLETTO CAMEO"


Première création toute simple d'une collection...
(avec un magnifique cabochon de Milena Scarcella de CabochonMania, cristal, chaîne strass, montage à la soutache)

Gros plan sur ce magnifique cabochon entièrement fait main:


Et voici le collier...montage sobre pour ne pas "étouffer" la beauté du cabochon.



     Collier         "LE FLAMANT NOIR"


(Soie plissée shibori de Céline Souchu - Cabochons d'Ivanna Harchenko -

Cristal - Fleur en cuir d'agneau de ma fabrication)




Cousin du collier "BALI", voici le collier "JAVA" et le bracelet assorti.


Parure "JAVA"

(cabochons de Stefania Iucci - soie plissée shibori de Céline Souchu - cristal - chaîne strass)




Bracelet "JAVA"


Parure "JAVA"


Collier et Pendentif      "IVANKA"


(cabochons de l'artiste russe Ivanna Harchenko - Soie shibori de Céline Souchu
cristal , verre de Bohême, torque)

Collier-torque "IVANKA"




Pendentif "IVANKA"





Collection "EXOTICBIRD" suite


(cabochon créé par Milena Scarcella, soie shibori artisanale de Céline Souchu, cristaux, verre, chaîne strass )



(Soutache, Verre de Bohëme, Cabochons créés par Milena Scarcella, )



(Cabochons de Teresa Ferreira Lopes , soutache, verre de Bohême, cristal)




Clin d'oeil "ART NOUVEAU " ...
avec ces cabochons entièrement faits main de Milena SCARCELLLA (Artisanat dArt- Italie), de la soie shibori de Céline SOUCHU (teinte et plissée main), le tout cousu à la soutache, et agrémenté de verre de Bohême et de cristal. .





Collier et bracelet
"La feuille d'automne emportée par le vent..."

Montage simple pour laisser la vedette à ces 2 magnifiques cabochons de Miss Bristling (Teresa Ferreira Lopes)... cabochons entièrement faits à la main (base polymère-décor-résine) . Tout de cou, bracelet, fleurs et feuilles en cuir; dagues en verre de Bohême, soutache .








Encore une Kokeshi ( ou Kimmidoll) avec un cabochon d'Elga Casagni, de la soutache, de la soie plissée Shibori et de la chaîne strassée. Doublure en cuir d'agneau.



Début d'une collection


Avec les magnifiques cabochons peints à la main par l'artiste italienne Simona Secchi !
Aujourd'hui clin d'oeil vers COLOGNE et son coucher de soleil...

Le collier "COLOGNE"



Les boucles d'oreilles "COLOGNE"


Collection...                     "COLIBRI DE FEU"   (1)


Un jour, dit la légende, il y eut un immense incendie de forêt. Tous les animaux terrifiés, atterrés, observaient impuissants le désastre. Seul le petit colibri s’activait, allant chercher quelques gouttes avec son bec pour les jeter sur le feu. Après un moment, le tatou, agacé par cette agitation dérisoire, lui dit : "Colibri ! Tu n’es pas fou ? Ce n’est pas avec ces gouttes d’eau que tu vas éteindre le feu ! "

Et le colibri lui répondit : "Je le sais, mais je fais ma part."


(soutache, soie plissée shibori de Céline SOUCHU, cabochons entièrement faits main -polymère pigments et résine- par l'artiste italienne Olimpia CORVINO, cristal, chaîne strassée, verre de Bohême, doublure cuir d'agneau)


                                                                      Et quelques gros plans ...



Collection ...

Toujours avec un magnifique cabochon peint à la main, de Simona SECCHI, nous partons vers Moscou ... et les clochers à bulbes de Saint-Basile

Voici le ....                Pendentif "BASILE"




Collier  "BALI"

Turquoise et or...
     ... avec les magnifiques cabochons de Stefania Iucci entièrement faits à la main, de la soutache, du cristal, du verre et de la chaîne strass...



                                               Gros plan sur les cabochons
                     Base en polymère, puis peinture et décor, le tout recouvert d'une résine.


Cycle Laurel BURCH...


En hommage à ce peintre américain, voici le collier ...

          CELESTIAL DREAMS (1)

                                ( Cabochon de Sara BOTTONI , soutache, cristal, verre de Bohême et cuir pour les planètes)




Kimmidoll ... Kokeshi...
    Pendentif  "Mamzelle ELGA SHIBORI"

       (cabochon d'Elga Casagni - soutache - soie plissée shibori de Céline Souchu - chaîne de strass - cristal Swarovski - verre)


     Collier      "SHIBORI SIMONA"


    (Cabochon entièrement fait main, style "Shibori" par Simona ROTARIS - Soie plissée Shibori - cristaux - soutache - chaîne strass - rocailles Miyuki)





                Parure         BUMBLE BEE


Avec des cabochons en pierre naturelle...
(BumbleBee, c'est le bourdon)
Le montage est sobre pour laisser la vedette à cette superbe pierre !
(soutache, verre, cristal, pierre semi-précieuse)



       Bumblebee3bis.JPG Bumblebee4bis.JPG


                                           ...dans mes tons préférés


(cabochon de l'artiste Ivanna Harchenko - soie shibori - cristaux - verre - cuir d'agneau)





Nouveau sautoir...
          "EXOTICBIRD Simona"
...Création à 4 mains avec les superbes cabochons de Simona !!!
Les cabochons sont faits avec une base en polymère, puis sont peints à la main et recouverts d'une résine.



Ultra violet de Pantone (couleur phare de l'année 2018) associé au vert printanier...
Voici      ....            "GIOIELLO IN FIORE"


(cuir, soutache, soie plissée shibori, cristaux, verre et...
cabochon entièrement fait main par Silvia María Díaz Martín ).

violettes.jpg                                                                         Muscari.jpg






Kimmidoll...Kokeshi ...
                   Voici  "MAMZELLE ELGA"

                            (Cristal - Cabochon fait main d' Elga Casagni - soutache- perles "Amos" en verre de Bohême)



...Avec la collaboration de plusieurs créatrices :


Elga CASAGNI pour les cabochons
Céline SOUCHU pour la soie plissée "Shibori"
(cristaux Swarovski - torque en acier)




Fruit d'une collaboration avec Milena Scarcella (pour le magnifique cabochon)...
Voici le collier - torque


                                                    (Cabochon polymère , soutache, verre de Bohême et torque en laiton)






L'or et le noir sont très tendance ... Voici donc ma "tenue" pour les Fêtes...
                                                            (cristal Swarovski, soutache, verre de Bohême)

ARABESQUE , c'est le module 1 du collier "SHEHERAZADE" que j'avais créé pour le concours Swarovski/Perles&Co/Marie Claire Idées.

Chauds les marrons chauds !!!
Juste avant l'arrivée officielle de l'hiver, voici...
           "DAME CHATAIGNE"
                    Gold stone, quartz druzy gold, cristal Swarovski, verre de Bohême, soutache, cuir, torque laiton )



      "   HYPNOTIC' KAA   "

C'est mon dernier pendentif (soutache, onyx, cristal Swarovski, perles Miyuki)
...avec un petit air de DORI ma grande inspiratrice,
...mais aussi de KAA le serpent hypnotiseur de Moogli !!!




      Collection TOUTENCUIR rouge

                          Découpage, façonnage, sculpture pour un effet relief dans le cuir

Toutencuirouge2.JPG Toutencuirouge1.JPG



                          Voici mes derniers pendentifs DIONYSOS :

"Beaujolais nouveau", "Gewurztraminer Vendanges tardives" et "Pinot Noir"
              ...A consommer sans modération!

                                                  (Cuir et pierres semi-précieuses : Agates et hématite)

                                                            BEAUJOLAIS NOUVEAU

                                               GEWURZTRAMINER -Vendanges Tardives    


            BEAUJOLAIS VILLAGE NOUVEAU                       ALSACE - PINOT NOIR   

DionysosAlsacePinotNoir.JPG DionysosBeaujolaisnouveau2.JPG

                                           ... Et voilà toute ma cave !!!


Bijoux transformables... 3 en 1... (pendentif, bijou de sac, broche)...
                      Voici mes nouveaux "DAROUS"
                                                (en cristal, brodés à la soutache)




Daroubleu.JPG Darouderriere.JPG Darouvert.JPG

                 Sautoirs "ALBI"

(Cabochons métalliques sertis à l'aiguille avec des rocailles et des délicas japonais - schéma de PUCA - le tout monté avec des pompons rebrodés eux aussi et une longue chaîne.)
La mode est aux ras-de-cou, mais sur un pull à col roulé, le sautoir est plus facile à porter.


Albi3bis.JPG Albi4bis.JPG


Toujours fan de dagues !!!...   Voici mes pendentifs 
                                  **EXOTIC BIRDS**
                                  (larme et feuille en hématite, dagues en verre de Bohême et soutache)


Exoticbirds5bis.JPG Exoticbirds7.JPG

Exoticbirds8.JPG Exoticbirds10.JPG


         EN HABIT  DE CUIR



Pierresenhabitdecuir3.JPG Pierresenhabitdecuir4.JPG

                      Couleurs printanières pour le collier
              "ROSE AU VENT"

                                                 (Soie plissée SHIBORI , cristal Swarovski, flèches de nacre et soutache)


Temps exécrable sur les Vosges...
                            Grande envie d'évasion vers le soleil et les îles grecques...

                                       Voici "MYKONOS"
                    ...variation de cuir autour d'un magnifique cabochon Onyx Drussite Agate.


Le rose est très tendance...             
                     Pendentif  " PINK CANDY "
                           Cuir d'agneau et pierre  "Pink Matrix & Pyrite" de Céline SOUCHU


Pendentifbonbonrose2.JPG Pendentifbonbonrose3.JPG

Nouveau look pour ma chouette 2017 !
                                  Voici "VALENTINE" !!!

Cette année le plumage de ma chouette est réalisé avec les perles japonaises "Long Magatama" qui se recouvrent partiellement à la façon des toujours les dagues pour les plumes de la queue.


Nouveau coeur Shibori...
         " CHAMADE "

( Soie Shibori - Chaîne, toupies, cabochon en cristal Swarovski - dagues et O Beads en verre de Bohême -  soutache - fleurs en métal satiné - doublure en cuir d'agneau - montage mixte en collier 45cm cuir et en sautoir sur chaîne argentée)


Coeurchamade2.JPG Coeurchamade3.JPG

                                                          Et une photo de profil pour admirer le gonflant du shibori !!!


Prémices de la Saint Valentin...    Soie shibori rouge , cristal , soutache , hématite et ruban de velours





Cuir d'agneau velours beige et sertissage cuir d'une goutte hématite...
          Voici ...  " GOUTTE DE VENT "


gouttedevent2.JPG gouttedevent3.JPG gouttedevent4.JPG gouttedevent5.JPG

gouttedevent6.JPG gouttedevent7.JPG

Pendentif HEDWIG
                       ... dernier né de mes pendentifs "chouettes"
                                                              (d'après une création de Vezsuzsi)
      (Tissage de perles avec cristal Swarovski - verre de Bohême - perles japonaises Myuki)


PendentifHedwig2.JPG PendentifHedwig4.JPGPendentifHedwig3.JPG



Pendentif "HEDWIG" de Vezsuzsi.
(cristal Swarovski - verre de Bohême - perles japonaises Myuki)




Mamzelle Pacotille en concours !
Je tente ma chance au grand concours Perles&CO/ Swarovski

         Collier SHEHERAZADE ou le mouvement dans les danses orientales
                       ... inspiré de cette photo du Ballet "Shéhérazade" - Rimsky Korsakov.





        Collier "BOHEME D'AUTOMNE"

              Que faire avec une véritable feuille d'érable galvanisée cuivre,
                                                                       des dagues en verre de Bohême
                                                                              un tour de cou en métal et du cuir ?
                                        ...un exercice de gainage avec du cuir .





Dans la Collection " PRINCESSE INDIA ",

         il y avait le bracelet braceletprincesseindia2.JPG   et les boucles d'oreilles  BOprincesseindia2.JPG 

                               Voici le collier-torque
                      (mélange de 2 techniques: Soutache et Soie Shibori)


colliertorqueprincesseindia3.JPG colliertorqueprincesseindia4.JPG

Un collier-torque turquoise dans ...
la Collection "PRINCESSE INDIA"
(Cristaux, soutache et soie Shibori)


      collierPrincesseIndiableu5.JPG collierPrincesseIndiableu6.JPG

Et sur fond blanc maintenant...

     collierPrincesseIndiableu12.JPG collierPrincesseIndiableu13.JPG collierPrincesseIndiableu14.JPG

           BYBLOS rosé
Pendentif...Cabochon en Agate druzy, perles en agate, cuir d'agneau, tour de cou en cuir tressé.

collierBYBLOS1.JPG collierBYBLOS3bis.JPG


(*Jaspe sédiment multicolore - Variscite et pyrite * Montage sur cuir de veau * *Sertissage avec fils de cuir 2mm et 1mm * Tour de cou en cuir ) 
       Montage sobre pour laisser la vedette à ces superbes perles ! 


                     CollierDoigtsdeJaspe2.JPG CollierDoigtsdeJaspe3.JPG

   Collection "KALANCHOE"

Du cuir et du métal...          

parureKalanchoe2.JPG parureKalanchoe3.JPG

Par une nuit d'orage surgit...

                    ... BIJOU DE SAC 
            (soutache - yeux en verre - "bouche" en cristal Swarovski - "cils et cornes" en verre de Bohême)





                   Retrouvez son frère , le "DAROU JOYEUX" dans la rubrique "BESTIAIRE"

  La famille "QUETZAL"(oiseau d'Amérique Centrale)
                                                                                   s'est agrandie...

                      ...Et en partenariat avec Perles&Co, j'ai fait un tutoriel que je partage ici :

                                       Alors n'hésitez pas, lancez-vous dans la soutache !!!
                                 (avec ma technique "collé / cousu", vous obtiendrez un joli résultat)


                          Quetzal101.JPG Quetzal102.JPG


               sont arrivées...

                                                         Des cadeaux en perspective !!!

       Chouettesdelete2.JPG Chouettesdelete3.JPG Chouettesdelete4.JPG Chouettesdelete5.JPG




             Pendentif DIONYSOS
(Cabochon et perles rondes en Agate Dragon Veine - cordons cuir - cuir d'agneau)


pendentifDionysos2.JPG pendentifDionysos3.JPG pendentifDionysos1.JPG

En hommage à Victor HUGO...


La pauvre fleur disait au papillon céleste :
- Ne fuis pas !
Vois comme nos destins sont différents. Je reste,
Tu t'en vas !

Pourtant nous nous aimons, nous vivons sans les hommes
Et loin d'eux,
Et nous nous ressemblons, et l'on dit que nous sommes
Fleurs tous deux !

colliercuirpapillon1.JPG colliercuirpapillon2.JPG

colliercuirpapillon3.JPG colliercuirpapillon4.JPG

          Collier "DIGITALIS"

                                    ...   dans la série des colliers "GEOMETRIE 3D"               
                                                                     (cuir de veau - fils de cuir -  perles magiques)


collierdigitales2.JPG collierdigitales1.JPG





DAHU ou DAROU dans les Vosges. Vous connaissez ?
C'est un animal brun-gris qui a deux pattes latérales plus courtes que les deux autres, ce qui donne au Darou un avantage certain pour circuler à flanc de montagne. Le côté où les pattes sont plus courtes détermine donc le sens dans lequel le Darou tourne autour des montagnes !!!
Comment chasser le Darou ?
Rien de plus simple que de chasser le darou : il suffit de placer du sel sur sa queue ou de siffler. L'animal va se retourner, ses pattes plus courtes vont se retrouver alors dans le vide et le darou va rouler dans la pente !!!
Le Darou étant un animal nocturne, il convient de le chasser entre le crépuscule et l'aube.


                      Petit coup de jeune à ce DAROU légendaire...
                                  et voici ce que j'en ai fait ...
                             (Cristal Swarovski - Verre de Bohême - soutache - cuir - métal)


          DahuJoyeux2.JPG DahuJoyeux3.JPG



Sertissage avec fils de cuir pour ce magnifique cabochon en Jaspe Sédiment orange. Chapeau bibi en cuir d'agneau velours.


collierjaspesedimentorange1.JPG cillierjaspesediment3.JPG

           Parure "SEVENTIES"

La tapisserie de ma salle à manger dans les années 70......   0294017E04824446-c1-photo-motifs-seventies.jpg
...Quelques années ont passé....
...Petite inversion des couleurs, rétrécissement des motifs (heureusement !!!)...
Et voici ma dernière création ... toute en cuir !!!


collierSeventies2.JPG BraceletetBOSeventies.JPG ParureSeventies.JPG

                              Collier                                          Boucles d'oreilles et Manchette                         La parure complète

Ce n'était pas exactement ce que j'avais prévu...
            ... j'ai dû être quelque peu influencée par cette période de Pâques, pour ainsi habiller de cuir ma superbe  Agate Titanium Druzy !!!


collierAgatedePaques2.JPG collierAgatedePaques3.JPG collierAgatedePaques4.JPG 

Collier et Boucles d'oreilles en cuir d'agneau et strass Swarovski ...
colliercuirSoleilsdeMars1.JPG BOcuirSoleilsdeMars2.JPG



            (Cabochon goutte et perles rondes en hématite, fils de cuir 1.5mm et1mm, cuir d'agneau pour la drappé)


       index.jpg Pendentifhematitecuirrouge1.JPG pendentifhematitecuirrouge4.JPG

              "PRINTEMPS DE JADE"

     Cocktail printanier ... Cuir découpé et façonné, soutache et pierres de jade purple.
                     (Envers du cuir pour les fleurs, endroit pour les feuilles)


collierprintempsdejade6.JPG collierprintempsdejade1.JPG collierprintempsdejade5.JPG collierprintempsdejade4.JPG

La famille MOKIKO est maintenant au complet avec
        Mamzelle "AMPHORA"
(Visage peint à la main sur polymère, soie Shibori, soutache, cristal et strass Swarovski, cuir)

MamzelleAmphora2.JPG MamzelleAmphora1.JPG MamzelleAmphora3.JPG

Toujours avec une jolie frimousse peinte par MOKIKO, voici ...
  Mamzelle "Princesse des Neiges"

(Visage peint à la main sur pâte polymère - soie Shibori - cristal - chaîne de strass Swarovski - verre de Bohême - chaîne serpentine - doublure cuir)

 MamzellePrincessedesNeiges7.JPG  MamzellePrincessedesNeiges11.JPG  MamzellePrincessedesNeiges8.JPG

MamzellePrincessedesNeiges5.JPG  MamzellePrincessedesNeiges1.JPG MamzellePrincessedesNeiges10.JPG

       Mamzelle MOKIKO
             1ère Mamzelle en soutache.

(Création en soutache en collaboration avec l'artiste italienne "MOKIKO" qui peint -ici un visage- sur de la polymère) . Toutes ses créations sont signées.

Mokiko1.JPG Mokiko2.JPG Mokiko3.JPG



J'espère avoir rendu hommage à sa création. Mes prochaines Mamzelles MOKIKO seront habillées de soie Shibori cuir. Mais chut, c'est encore un secret !

Avec des Ammonites de Madagascar, une parure pendentif/boucles d'oreilles ...
                            " Fôsily Amonita "
(Ammonites de Madagascar, jaspe paysager, soutache métallique, rocailles et délicas japonais, doublure cuir)

Nouveau miroir...
            ... MIROIR AMETHYSTE

miroiramethyste1.JPG miroiramethyste2.JPG
                  Et sur fond clair ...
miroiramethyste3.JPG miroiramethyste4.JPG

Et maintenant Mamzelle ...
                     DEESSE ... ISIS

(Cabochon-visage de Kristie-Lou, soie Shibori, soutaches métalliques, verre facetté, dagues en verre de Bohême, rocailles japonaises en plaqué or, cuir pour l'arrière.)

                   pendentifisis1.JPG pendentifisis3.JPG

                                                                    pendentifisis2.JPG pendentifisis4.JPG

Nouvelle Mamzelle ...
                             LA DEESSE BLEUE

(Avec un cabochon de la talentueuse créatrice américaine...Kristie Brigham (Kristie-Lou), de la soie shibori, de la chaîne strassée, du cristal Swarovski et des perles Myuki)


Pendentifdeessebleue2s.JPG Pendentifdeessebleue4.JPG

Un collier-torque turquoise dans ...
la Collection "PRINCESSE INDIA"
(Cristaux, soutache et soie Shibori)


      collierPrincesseIndiableu5.JPG collierPrincesseIndiableu6.JPG

Et sur fond blanc maintenant...

     collierPrincesseIndiableu12.JPG collierPrincesseIndiableu13.JPG collierPrincesseIndiableu14.JPG

Avec de beaux cabochons en verre taillé achetés en Turquie, du cristal Swarovski, du verre de Bohême, des apprêts-métal en doré satiné et de la soutache métallisée, voici le premier de la collection " Pendentif MIROIR "...
                               " MIROID'ETE "

miroirdete1.JPG miroirdete2.JPG
             sur fond blanc

Pendentifs "MAHAKALA"  (Masques tibétains)


Mahakalarouge1.JPG Mahakalarouge2.JPG




C'est bientôt la Saint Valentin...
                       1er de la collection "CoeurShibori"

              le pendentif    "JOLI COMME UN COEUR"

                                                           (Soutache, soie Shibori, cristal, verre, rocailles et doublure en cuir)



                                                                           pendentifcoeurShiborivert3.JPG  pendentifcoeurShiborivert4.JPG Dans la Collection "CoeurShibori"
                  Le pendentif  "ACCROCHE-COEUR"

                   Coeur brodé sur Lacy's stiff stuff (sorte d'intissé) avec inclusion de Soie Shibori plissée.
   (soutache - jade purple - cristal - dagues et O bead en verre de Bohême - chaîne strassée - rocailles japonaises )

pendentifaccrochecoeur0.JPG pendentifaccrochecoeur1.JPG
pendentifaccrochecoeur2.JPG pendentifaccrochecoeur3.JPG

Doublure en cuir à l'arrière....                           pendentifaccrochecoeur4.JPG

...La collection "COEURSHIBORI" s'enrichit avec
                    Le pendentif  "COEUR ENFLAMME"

                                                              (Soie Shibori - cristal - chaîne strassée - soutache - rocailles myuki)





                        7 janvier 2015....
                     Ensemble ....
                             LARMES DE SANG


(Pendentif et bague : Navette et chaîne strass en cristal Swarovski - cabochons ovales en verre de Bohême - rocailles et délicas japonais - perles magiques - soutache - chaîne serpentine)

                                                                             Même le temps est sombre pour la prise de vues....

pendentifLarmesdeSang1.JPG pendentifLarmesdeSang2.JPG



Toujours dingue de dagues!!!
                    Voici le collier "VENEZIA"


       (Tour de cou plat métal argenté - gouttes onyx - cabochons ronds et navette en cristal Swarovski - délicas japonais - soutache - dagues en verre de Bohême)


                                                                                            collierVenezia2a.JPG  parureVeneziacollierbracelet.JPG


Collier de la collection " AZTEKOK ROUGE"


ColliertorqueAztekokrouge2.JPG  ColliertorqueAztekokrouge3.JPG


Pendentif "OUISTITI"

PendentifOuistitinoirargent1.JPG PendentifOuistitinoirargent2.JPG

Parée pour les fêtes avec le collier                       
             "TENUE DE SOIREE"



(Torque argent, soutaches noires et argent, cabochon ovale en verre de Bohême, cabochons chessboard-navettes-chaîne strass et gouttes "black patina" en cristal Swarovski)

                                                                                                          ...sur fond noir        

        colliertenuedesoiree1.JPG  colliertenuedesoiree2.JPG

                                                                                        ...sur fond blanc  (enfin, plutôt gris!!!)


                                                   Le collier-torque

                       (cristaux Swarovski - dagues en verre de Bohême - cubes Myuki japonais - soutache - torque en métal doré)


           collierautomneflamboyant2.JPG  collierautomneflamboyant3.JPG

           " SORCIERE NOIRE "

(collier-torque vintage en laiton plaqué argent - perle ovale et dagues en verre de Bohême - chaîne de strass Swarovski - perles et gouttes en Onyx - rocailles et cubes Myuki  japonais - cuir - soutache)

        colliereclosiondhiver1.JPG    colliereclosiondhiver2.JPG

        colliereclosiondhiver3.JPG colliereclosiondhiver4.JPG

      "Rossella", une chouette grenouille!

                                                                          (cristaux Swarovski Vitrail Médium - soutache - cuir)

Rossellagrenouille3.JPG Rossellagrenouille4.JPG

(base: torque en laiton vintage- cabochon et goutte en cristal Swarovski, ambre reconstitué, perles en verre de Bohême, rocailles japonaises et bien sûr...soutache)

Collier_TlacopanCirqueduSoleil1.JPG CollierTlacopanCirqueduSoleil2.JPG


Pendentif "OSCARQUETZAL"  (soutache et MALACHITE)

pendentifchouettelalachite.JPG pendentifchouettemalachitegrosplan.JPG



Tenue de "Soierie" pour
"Mam'zelle SHIBORI
                        et Cie "

Le "Shibori" est une technique japonaise de teinture de tissu (ici de la SOIE).
Le tissu est plissé, noué, ligaturé de telle sorte que la teinture n'atteint pas toutes les parties du tissu.
L'effet "déplié" est très joli, et sur la soie, c'est très lumineux.


Mais j'ai eu tout de suite envie de rhabiller mes mamzelles de ces soieries précieuses!

         mamzelleshiboriviolette1.JPG mamzelleshiborivioletteetjauneorange.JPG



                                                                   Et avec ces 2 nouvelles couleurs de ruban...

mamelleshibori12.JPG mamzelleshibori13.JPG mamzelleshibori15.JPG


Dans un style rétro...un tantinet kitch,


                                              Un pendentif "ASYMETRIK"
                              utilisant la teinte  "Crystal Lilac Shadow" de Swarovski
                                               avec son flashage métallique doré


pendentiflilacshadow3.JPG  pendentiflilacshadowgrosplan5.JPG



Des copines pour GrandZibou Hedwig

    chouettebleuesurmain.JPG  chouettebleue.JPG

    chouettebeige.JPG  chouettenoire.JPG

          Pendentif      GrandZibou "HEDWIG"

grandzibou4.JPG grandzibou1.JPG




collierluminous1.JPG collierluminousgrosplan.JPG

Nouvelle technique, nouvelle matière: LA SOUTACHE

Le pendentif "TrèsChouette"

pendentifsoutachechouetteplanmoyen.jpg  pendentifsoutachechouettegrosplan.jpg

Pendentif "DORI"

soutachependentifonyxargentgrosplan.jpg      soutacheparurependentifBOonyxargent.jpg

La bouteille à message...(avec Haïku ou message personnalisé)
                                              (le principe de ce modèle sera renouvelé pour la St Valentin)

bouteillenoiror1.jpg bouteillenoiror2.jpg bouteillenoiror3avecmessage.jpg

Pendentif "Bulle de verre" (avec roses séchées)

collierbouleverreroses1.jpg collierbouleverreroses2.jpg collierbouleverreroses3grosplan.jpg

Collier "potirons" en noir et blanc...toujours tendance ... et les boucles d'oreilles assorties

        collierpotironsnoirblancBOassorties.jpg BOgirafenoirblanc.jpg

Pendentifs brodés...  "LES ASYMETRICK"

pendentifasymetrichastralpink.jpg pendentifasymetrickturquoiseetastralpink.jpg pendentifasymetrickturquoise.jpg



De la collection OR/BRONZE

                  colliercravatepotironkanzashiorbronze.jpg colliercravateorbronze2.jpg

Et un petit coup de baguette magique sur ...
                                             Le collier d'Halloween ... transformable!


colliersorciereavecsorciere.jpg colliersorcierequepotirons.jpg




Un "petit" collier textile/porcelaine froide:


    sautoirjosephine1.jpg  sautoirjosephine1bis.jpg

                                                             sautoirjosephine2.jpg  sautoirjosephine4.jpg  sautoirjosephine3.jpg






pendentifzibougrosplan2.jpg chouette2.jpg

Mes dernières petites chouettes! (elles plaisent décidément beaucoup)

chouettenoiror.jpg chouetteorange.jpg chouetterouge.jpg chouetteamethyste.jpg



Une fleur toute en finesse et en simplicité.

                C'est une création d'une perleuse de Haïfa (Israël): Isabella Lam.

                                                             Voici mon interprétation en noir et argent.

                                                              (Tout en "délicas", même le tour de cou!)






Pour aller avec la "bague GOURMANDE"...... Le "collier Gourmand"

colliergourmand1.jpg   colliergourmand2.jpg


Le Collier "MINI-BOUTEILLE" (remplie de micro billes de verre or)


collierbouteilledecodelicas.jpg collierbouteilledecodelicasgrosplan1.jpg


Du FUSCHIA et de l'ANIS - (Textile,strass, cristal)

collierfuschiaanis.jpg collierfuschiaanisetbijoudesac.jpg Voir le bijou de sac en détail dans la rubrique



Collier diététique "5 FRUITS ET LEGUMES"


         collier5fruitslegumes1.jpg  collier5fruitslegumes2.jpg











                                                   En miniature (à cliquer) la bague-bulle.


                       colliersenteurprintanieregrosplanrose.jpg  colliersenteurprintaniereparis.jpg


                                                                   bagueterrariumrose1.jpg bagueterrariumrose3.jpg colliersenteursprintanieres.jpg colliersenteurprintaniere2.jpg colliersenteursprintanieresgrosplanrose.jpg




Dans la série des colliers "textile"...




                               colliertextilemartiniquevertentier.jpg  colliertextilemartiniquevertfleurkanzashi.jpg colliertextilemartiniquevertpotirons.jpg colliertextilemartiniquevertpersonnage.jpg



Le sautoir "CAGE A ZOZIO"

                              fleurblanche.jpg sautoirnoirblanccagezozioargent1.jpg colliertextilenoirblanccage2.jpg




                       colliertextilecoccinelleentier.jpg colliertextilecoccinellepersonnageface.jpg colliertextilecoccinellepersonnagedos.jpg colliertextilecoccinellefleurkanzashi.jpg colliertextilecoccinellepotirons.jpg





                    collkanzashijaune.jpg colliertextilekanzashi5fleursvertpoismarron.jpg colliertextilekanzashi5fleursvertpoismarrongrosplan.jpg

- Retour haut de l'article

Dans la série des Colliers en Aluminium...


 Aluminium 2mm et 4mm - Orchidées en résine  -  Fleurs "Gerbéra" créées avec cabochon en cristal Swarovski et dagues en verre de Bohême

        collieralunoirorange1.jpg collieralunoirorange2.jpg collieraluorchideesfushia.jpg


       collieraluorchideesmarronanis.jpg collieralutresseorchideecuivre1.jpg collieralutorsadeorchideecuivre2.jpg


collieralugerberarougenoirgrosplan.jpg collieralutressenoirjaune.jpg collieralugerberaturquoise.jpg collieraluarabesquesmarronorgerbera.jpg collieralugerberaagateonyxnoirargent.jpg




- Retour haut de l'article

Petite série de pendentifs   -  "ROSES D'ANTAN" - sur des DONUTS en pierres semi-précieuses  


                                   Donut en Cornaline                                                                                  Donut en Turquoise

         donutdantan1.jpg donutdantan3.jpg


                               Donut en Howlite                                                                                 Donut en Améthyste

         donutdantan6.jpg  donutdantan8.jpg


                               Donut en Jaspe                                                                        Donut en Pierre de Soleil

          donutdantan7.jpg donutdantan4.jpg


- Retour haut de l'article


Série un peu plus sophistiquée....

...avec des cristaux Swarovski, des rocailles et des délicas  japonais


Pendentif "THOUERIS"

   Thoueris_swap_en_entier.jpg Thoueris_swap_avec_cordon_en_partie.jpg


                          Des cabochons en cristal Swarovski avec sertis en étoile rebrodés (à la façon d'OCEANIE).


                                pendentifcabochonsertietoilenoirargent.jpg pendentifcabochonsertietoilecrystalABargent.jpg



Le pendentif EYES

      pendentif_Eyes.jpg   pendentif_Eyes_gros_plan.jpg








Délicas tissés à l'aiguille pour ce pendentif et son tour de cou. (technique peyote) 


                                                                                                            Le collier "ISABELLAM"

                                                collierisabellam.jpg  collierisabellamgrosplan.jpg


Avec des cabochons "poires" Swarovski, le "TRI'ANGARA" (tissage herringbone pour le tour de cou)






- Retour haut de l'article


Toujours avec la même technique de tissage et broderie à l'aiguille, des colliers "GRAPPES" avec des Perles de perles (ou boules emperlées).

                                                       ( il s'agit de perles de bois recouvertes de délicas et rocailles)


                         Collier "SATURNA"

                         colliergrappeboulesperleessaturnagrosplan.jpg colliergrappeboulesperleessaturna1.jpg


  Collier "HELENE"

  collier_Helene.jpg collier_Helene_gros_plan_grappe.jpg



Et aussi des perles créées avec des cristaux Swarovski et des rocailles:

                                  Collier "TYARA"

collier_sylvie59_turquoise_argent_gros_plan.jpg  collier_sylvie59_turquoise_argent.jpg  collier_turqoisemarron_extrem.jpg collierpendentifbouleperlee.jpg                                                                                                                                                                                   Collier_Menthe_JetABX2_gros_plan.jpg Collier_Menthe_turquoise_gros_plan.jpg


Dans la collection "VERRE"...


 Avec de superbes perles  en verre de Murano.


                                                                                                         Collier "SATELLITE"



Avec ces perles en pâte de verre d'un artisan-verrier de Bohême ...


pateverrerose.jpg pateverreorange.jpg pateverrevert.jpg









- Retour haut de l'article

Date de création : 10/04/2013 @ 01:13
Dernière modification : 02/04/2021 @ 22:42
Catégorie : Par genre

Imprimer l'article Imprimer l'article

Nous contacter
Plaisir des yeux


 436923 visiteurs

 6 visiteurs en ligne

^ Haut ^